|
|
(22 intermediate revisions by 4 users not shown) |
Line 1: |
Line 1: |
| | [[Image:Pretty protein.PNG|centre|framed|'''Figure 1.''' ''2PBL'']] |
| | |
| | ''by Basma Al Alaiwat, Sebastian Mynott and Thomas Parker'' |
| | |
| == Abstract == | | == Abstract == |
| | |
| | 2PBL, initially annotated as an arylformamidase, was isolated from ''Silicibacter sp. TM1040'' and its structure determined by the JCSG. Based on structural, functional and evolutionary analysis, we have further characterised 2PBL. It was found to contain a conserved functional region present in A/B-hydrolases of many taxonomic groups. Specifically, it was found to share similar structural and sequence characteristics of the prokaryotic HSL family of esterases. Residues of a probable catalytic triad were identified as Ser137, His242 and Glu215. Further experimental characterisation of 2PBL is required to better understand its function. |
|
| |
|
| == Contents == | | == Contents == |
Line 21: |
Line 27: |
| [[Arylformamidase Structure | Structure]] - ''Basma Al Alaiwat'' | | [[Arylformamidase Structure | Structure]] - ''Basma Al Alaiwat'' |
|
| |
|
| [[Arylformamidase Function | Function]] - ''Thomas Parker'' | | [[Arylformamidase Function Slide 1 | Function]] - ''Thomas Parker'' |
| | |
| | |
| | |
| == Results ==
| |
| | |
| most similar sequence - catalytic triad, structure with highlighted
| |
| | |
| The most similar sequence with functional information available was that of an arylformamidase isolated from the liver of Mus musculus (see figure ...). A functional analysis of this protein has been performed identifying a catalytic triad using site-directed mutagenesis (Pabarcus et al. 2007). Conservation of this catalytic triad with 2pbl was assessed. Both residues S162 and H279 were found to be conserved in relatively conserved regions of the alignment. However, D247 had undergone a semi-conservative substitution. These residues correlated to S136, E214 and H241 of 2pbl which were subsequently located on the tertiary structure and determined to be sufficiently proximal to one another for catalysis (see figure...).
| |
| | |
| [[Image:arylformamidase_alignment.png|centre|framed|'''Figure 3:''' ''Conservation of the catalytic triad between Arylformamidase and 2pbl.'']]
| |
| | |
| most similar structure - catalytic triad, structure with highlighted
| |
| | |
| 2pbl was found to share most structural similarity with a thermostable carboxylesterase from an uncultured archaeon (PDB ID: 2c7b; see figure ...). 2c7b shares a 16% sequence identity with 2pbl. From its structure, a catalytic triad has been identified (how?). To substantiate any functional similarity between 2pbl and 2c7b, conservation of the 2c7b catalytic triad was analysed (see figure ...). All three residues were found to be conserved, though H... and E... were found to match is less conserved regions.
| |
| | |
| [[Image:2c7b_alignment.png|centre|framed|'''Figure 1:''' ''Conservation of the catalytic triad between 2cb7 and 2pbl.'']]
| |
| | |
| presentation of tree and alignments
| |
| | |
| == Discussion ==
| |
| | |
| probable function
| |
| | |
| The function of 2c7b has been well characterised (references).
| |
| | |
| additional info on probable function
| |
| | |
| Carboxylesterases have a common reaction mechanism (see figure ...). This is somewhat similar to the arylformamidase reaction mechanism incorporating hydrolysis of a ... bond.
| |
| | |
| evolutionary link...
| |
| | |
| biological implications/applications...
| |
| | |
| Potential thermostability - applicability in industry.
| |
| | |
| further research...
| |
| | |
| == Conclusion ==
| |
| | |
| == Methods ==
| |
| | |
| '''Literature search'''
| |
| | |
| A literature search was performed using the putative annotation ‘arylformamidase’. A paper by Pabarcus et al. 2007 was returned which, ironically, described the arylformamidase from Mus Musculus.
| |
| | |
| '''Conservation of Catalytic Triad'''
| |
| | |
| An alignment of 2pbl and the protein of interest was performed using ClustalX. Default parameters were used. Residues of the catalytic triad were identified from the paper describing it and located in the sequence. Conservation of the residue and the surrounding sequence was observed. Note: in analysing conservation of the 2c7b catalytic triad with 2pbl, the clustalW alignment was found to differ from the alignment provided as part of the DALI results.
| |
| | |
| == Additional Materials ==
| |
| | |
| '''Presentations'''
| |
| | |
| | |
| | |
| '''Links'''
| |
| | |
| [http://www.pdb.org/pdb/explore.do?structureId=2PBL Protein Data Bank Entry for 2PBL]
| |
| | |
| '''FASTA Sequence'''
| |
| | |
| >gi|146387357|pdb|2PBL|A Chain A, Crystal Structure Of Putative Thioesterase (Yp_614486.1) From Silicibacter Sp. Tm1040 At 1.79 A Resolution
| |
| GXELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDLFLPEGTPVGLFVFVH
| |
| GGYWXAFDKSSWSHLAVGALSKGWAVAXPSYELCPEVRISEITQQISQAVTAAAKEIDGPIVLAGHSAGG
| |
| HLVARXLDPEVLPEAVGARIRNVVPISPLSDLRPLLRTSXNEKFKXDADAAIAESPVEXQNRYDAKVTVW
| |
| VGGAERPAFLDQAIWLVEAWDADHVIAFEKHHFNVIEPLADPESDLVAVITA
| |
Latest revision as of 03:29, 10 June 2008
Figure 1. 2PBL
by Basma Al Alaiwat, Sebastian Mynott and Thomas Parker
Abstract
2PBL, initially annotated as an arylformamidase, was isolated from Silicibacter sp. TM1040 and its structure determined by the JCSG. Based on structural, functional and evolutionary analysis, we have further characterised 2PBL. It was found to contain a conserved functional region present in A/B-hydrolases of many taxonomic groups. Specifically, it was found to share similar structural and sequence characteristics of the prokaryotic HSL family of esterases. Residues of a probable catalytic triad were identified as Ser137, His242 and Glu215. Further experimental characterisation of 2PBL is required to better understand its function.
Contents
Introduction
Results
Discussion
Methods
Additional Materials
References
Presentations
Sequence & Homology - Sebastian Mynott
Structure - Basma Al Alaiwat
Function - Thomas Parker