Results (1zkd): Difference between revisions

From MDWiki
Jump to navigationJump to search
No edit summary
No edit summary
 
(105 intermediate revisions by 3 users not shown)
Line 1: Line 1:
==Structure of Hypothetical Protein LOC55471 Isoform 1==
==Structure of Hypothetical Protein LOC55471 Isoform 1==


Dali shows a few proteins with similar structure to 1zkd. They are 2ex4 and 1im8 which shows the highest Z-value of 11.7 and 11.6 respectively. 2ex4 is a human methyltransferase with S-adenosylhomocysteine and 1im8 is found to be a methyltransferase with a bound S-adenosylhomocysteine from the crystal structure of YecO from Haemophilus influenzae (HI0319).  
===Comparing Structure of Proteins===
 
'''Dali Results'''
 
Dali shows a few proteins with similar structure to 1zkd. They are 2ex4 and 1im8 which shows the highest Z-value of 11.7 and 11.6 respectively. The higher the Z-value the more significant is the results. However,  they are only 10-12% identical to the query protein. Nevertheless, these 2 proteins are used to compare with the query protein as these 10-12% identity may be at the binding site or ligand which will determine the functions. 2ex4 is a human methyltransferase with S-adenosylhomocysteine and 1im8 is found to be a methyltransferase with a bound S-adenosylhomocysteine from the crystal structure of YecO from Haemophilus influenzae (HI0319).  




SUMMARY: PDB/chain identifiers and structural alignment statistics
SUMMARY: PDB/chain identifiers and structural alignment statistics


NR. STRID1 STRID2  Z  RMSD LALI LSEQ2 %IDE REVERS PERMUT NFRAG TOPO PROTEIN
NR. STRID1 STRID2  Z  RMSD LALI LSEQ2 %IDE REVERS PERMUT NFRAG TOPO PROTEIN
  1:  3027-A 1zkd-A 56.8  0.0  349  349  100      0      0    1 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    duf185  (rhodops
  '''''1:  3027-A 1zkd-A 56.8  0.0  349  349  100      0      0    1 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    duf185  (rhodops'''''
  2:  3027-A 2ex4-A 11.7  3.0  185  221  12      0      0    22 S    TRANSFERASE      adrenal gland protein ad-003    (homo sapien
  '''''2:  3027-A 2ex4-A 11.7  3.0  185  221  12      0      0    22 S    TRANSFERASE      adrenal gland protein ad-003    (homo sapien'''''
  3:  3027-A 1im8-A 11.6  3.2  178  225  10      0      0    18 S    TRANSFERASE    yeco (methyltransferase, hypothetical pro
  '''''3:  3027-A 1im8-A 11.6  3.2  178  225  10      0      0    18 S    TRANSFERASE    yeco (methyltransferase, hypothetical pro''''' 4:  3027-A 2gb4-A 10.8  3.3  184  231  13      0      0    19 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
4:  3027-A 2gb4-A 10.8  3.3  184  231  13      0      0    19 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
  5:  3027-A 2fk7-A 10.7  3.8  186  277  14      0      0    19 S    TRANSFERASE      methoxy mycolic acid synthase 4        (mycobact
  5:  3027-A 2fk7-A 10.7  3.8  186  277  14      0      0    19 S    TRANSFERASE      methoxy mycolic acid synthase 4        (mycobact
  6:  3027-A 2ob1-A 10.2  3.9  196  319    9      0      0    23 S    TRANSFERASE      leucine carboxyl methyltransferase 1 (prot
  6:  3027-A 2ob1-A 10.2  3.9  196  319    9      0      0    23 S    TRANSFERASE      leucine carboxyl methyltransferase 1 (prot
Line 17: Line 20:
  9:  3027-A 2bzg-A  9.9  3.4  182  226  13      0      0    20 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
  9:  3027-A 2bzg-A  9.9  3.4  182  226  13      0      0    20 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
  10: 3027-A 2aot-A  9.8  4.3  182  285  13      0      0    23 S    TRANSFERASE      histamine n-methyltransferase (hmt)    (homo
  10: 3027-A 2aot-A  9.8  4.3  182  285  13      0      0    23 S    TRANSFERASE      histamine n-methyltransferase (hmt)    (homo
'''Alignment with Known Proteins'''


1zkd is an unknown protein, and by using proteins similar to it, the functions of this unknown protein can be predicted. With 2ex4 and 1im8 showed by Dali to be the most similar, other tools are used to determine the similarity. Combinatorial Extension Method is used. Below shows the sequence alignment and structure alignment of the unknown protein with the proteins obtained from dali:
1zkd is an unknown protein, and by using proteins similar to it, the functions of this unknown protein can be predicted. With 2ex4 and 1im8 showed by Dali to be the most similar, other tools are used to determine the similarity. Combinatorial Extension Method is used. Below shows the sequence alignment and structure alignment of the unknown protein with the proteins obtained from dali:


Alignment with 2ex4
'''2ex4'''
 
Alignment with 2ex4
  1ZKD:A  24/25    WRYXELCLGHPEHGYYV--TRDPLGREGDFTTSPEISQXFGELLGLWSASVWKAAD-EPQ
  1ZKD:A  24/25    WRYXELCLGHPEHGYYV--TRDPLGREGDFTTSPEISQXFGELLGLWSASVWKAAD-EPQ
  2EX4:A  24/7    IEDEKQFYS----KAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTG
  2EX4:A  24/7    IEDEKQFYS----KAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTG
Line 31: Line 38:
  1ZKD:A  251/252  GDTFQAIASHSYADPLQHPGRADLTAHV---DFDALGRAAESIGARAHGPVTQG
  1ZKD:A  251/252  GDTFQAIASHSYADPLQHPGRADLTAHV---DFDALGRAAESIGARAHGPVTQG
  2EX4:A  191/175  GVILDD---------------VDSSVCRDLDVVRRIICSAG---LSLLAEERQE
  2EX4:A  191/175  GVILDD---------------VDSSVCRDLDVVRRIICSAG---LSLLAEERQE
[[Image:2ex4 jmol.JPG|thumb|250px|Figure 3. Structure of 2ex4|left]]
[[Image:Structure aling.JPG|thumb|300px|Figure 4. Structure Alignment with 2ex4 (Blue:1zkd, Purple: 2ex4)|left]]
Alignment Length: 294
Gaps (average per molecule): 53.5
Sequence Identity: 14.4%
RMSD min – max: 3.03A
'''1im8'''


  Alignment with 1im8
  Alignment with 1im8
Line 42: Line 86:
  1IM8:A  157/155  ---NPNGVLVLSEKF
  1IM8:A  157/155  ---NPNGVLVLSEKF


[[Image:Structure aling.JPG|thumb]]
[[Image:1im8 jmol.JPG|thumb|250px|Figure 5. Structure of 1im8|left]]
 
[[Image:Structure alig.JPG|thumb|300px|Figure 6. Structure Alignment with 1im8(Blue:1zkd, Purple: 1im8)|left]]
 
 
Alignment Length: 195
 
Gaps (average per molecule): 38.5
 
Sequence Identity: 11%
 
RMSD min – max: 2.3A
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 


Structure Alignment with 2ex4 (Blue:1zkd, Purple: 2ex4)


Alignment Length: 294
===Ligand and Binding Sites===
 
[[Image:Binding sites.JPG|thumb|600px|Figure 7. Binding Sites|left]]
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
[[Image:Ligand.JPG|thumb|400px|Figure 8. Conserved regions|left]]
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
===Domain===
 
'''InterPro Results'''
 
[[Image:InterPro.JPG|Thumb|InterPro Scan Results|Left]]
 
 
'''Pfam Results'''
 
DUF185: domain 1 of 1, from 64 to 299: score 227.1, E = 3.9e-65
                  *->alArwllveykllgyPYadlnlvElGaGrGtaielmsdlLryiarlv
                      +l++w + ++k+ ++P  l+l E+G+GrGt  +m+d+Lr+  r+
      query    64    LLGLWSASVWKAADEP-QTLRLIEIGPGRGT---MMADALRA-LRVL 105 
                  PdvyartryylvEiSprLaarQketLapkvaplGhdskveieatdlsglv
                  P +y+ ++++lvEi+p L+++Q++ La                ++  ++
      query  106 PILYQSLSVHLVEINPVLRQKQQTLLA-----------------GIR-NI 137 
                  rWhdasileedPdgvptvliaNEVlDalPHDlvrfdkrgggwyErhVlvd
                    Whd s +e++P+g p v++aNE +D lP  +++ +kr+ gw+Er V ++
      query  138 HWHD-S-FEDVPEG-PAVILANEYFDVLP--IHQAIKRETGWHER-V-IE 180 
                  ldgdfrlvysqeldplaglaltlreaaldPVKstkklvpsalskllpkll
                    + ++lv+++++dp  g+                            ++l
      query  181 IGASGELVFGVAADPIPGFEAL------------------------LPPL 206 
                  ppaeevgygtEvYsParllellqalaerLpahrGrlLaiDYGhlaseyyh
                    +  +g+++E+  P    e+l+++ +  +  +G++L+iDYGhl+s   
      query  207 ARLSPPGAVFEW-RPDT--EILKIASRVRD-QGGAALIIDYGHLRSD--- 249 
                  prrksalaaemfngtllqayrqhahddpltnpssllVlyStvaqGlaDiT
                                g+++qa+  h + dpl +p            G+aD+T
      query  250 ------------VGDTFQAIASHSYADPLQHP------------GRADLT 275 
                  ahVDFtalaradqyqtaakaagdlkvlgvet<-*
                  ahVDF+al      +aa  +g + + g+ t 
      query  276 AHVDFDALG------RAAESIG-ARAHGPVT    299
 
Domain DUF 185 has been identified by InterPro and Pfam as show above. In Pfam the E value of 3.9e-65 gives significant results showing that it is not by chance nor random that the match made was DUF185. DUF 185 belong to the family of RNA methyltransferase.
 
==Function of Hypothetical Protein LOC55471 Isoform 1==
 
===ProFunc analysis reveals methyltransferase activity as the most likely biochemical function===
By using ProFunc (Laskowski et al, 2005) the most likely biochemical function of the unknown bacterial Protein 1zkd was determined as Methyltransferase.
Matching structures were determined by SSM Secondary Structure Matching (Krissinel & Henrick, 2004) showing possible matches with 9 Methyltransferases from both human and bacteria (Fig.9).
 
 
[[Image:Image001.png|thumb|600px|Figure 9. SSM results showing ten sequences with a sequences id around 20 % with higher matching folds.|center]]
 
 
Ligand Template Matches LIG (Laskowski et al, 2005) revealed a probable match with the Protein-l-isoaspartate o-methyltransferase 1dl5 (Fig.10).
 
[[Image:Image003.png|thumb|600px|Figure 10. LIG results support the hypothesis of 1zkd being a methyltransferase.|center]]
 
 
REV Reverse Template Matches (Laskowski et al, 2005) also showed probable matches for several methyltransferases (Fig.11).
 
 
[[Image:Image005.png|thumb|600px|Figure 11. REV results showing five probable matches, which are all methyl or dimethyltransferases.|center]]
 
 
Superfamily program searches against a library of Hidden Markov Models HMMs (Gough et al, 2001; Madera et al, 2004) derived from SCOP families revealed similarities to the superfamily S-Adenosylmethionine-dependent Methyltransferases (E-value 6.69e-06). No DNA binding motifs (helix-turn-helix) were found in the ProFunc search.
 
===Genomic context of the 1izkd gene===
 
Genomic context of 1zkd in the genome of Rhodopseudomonas palustris from the NCBI Entrez Gene database shows a genomic co-localisation with another transferase, an oxidase, a kinase and another hypothetical protein (Fig.12).
 
 
[[Image:Image007.png|frame|center|Figure 12. The RPA4359 gene of the protein 1zkd is co-located with an upstream prolipoprotein diacylglyceryl transferase gene (1gt) and downstream with a multicopper polyphenol oxidase (RPA4360), a ribose-phosphate pyrophosphokinase (ribP) and another hypothetical protein of unknown function gene (RPA4361).]]
 
===Localisation of 1zkd orthologs in the cell===
 
Nucleo (Nuclear Protein Localisation Prediction) predicted a chance of 0.07 for the mouse ortholog and a chance of 0.20 for the human ortholog of 1zkd to be located in the nucleus (Hawkins et al, 2006).
 
LOCATE data was available for the mouse ortholog showing that it is a soluble, non-secreted protein with higher scores for a localisation in mitochondria or the cytoplasm (Fink et al, 2006).
 
 
===Expression profiles of mouse and human orthologs===
 
Expression profile data of the mouse and human ortholog were suggested by analysis of EST counts from NCBI UniGene database (http://www.ncbi.nlm.nih.gov/sites/entrez?db=unigene). ESTs were found in diverse tissues including brain, liver, lung, muscle and endocrine system showing that the target protein is expressed in a wide range of different cells (Fig.13a,b).
 
[[Image:Image009.png|left|thumb|300px|Figure 13a. Expression profile of the mouse ortholog.]]
[[Image:Image011.png|none|thumb|300px|Figure 13b. Expression profile of the human ortholog.]]
 
===Electrostatic properties of the 1zkd protein surface===
 
Electrostatic properties and surface charges of 1zkd were modelled using Adaptive Poisson-Boltzmann Solver APBS (Baker et al, 2001) and visualisation was performed by using Pymol (http://www.pymol.org). According to the resulting model, the 1zkd protein got a mostly negatively charged surface (Fig.14a,b), indicating that interactions with the negatively charged backbone of nucleic acids are rather unlikely.
 
[[Image:Surface charges 1zkd.PNG|left|thumb|500px|Figure 14a. Surface charges of 1zkd as a dimer. Red colour indicating negative charges, blue colour indicating positive charges.]]
 
[[Image:Surface_charge.JPG|left|thumb|300px|Figure 14b. Surface Charges of Protein. Red colour indicating negative charges, blue colour indicating positive charges]]
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
== Evolution of Hypothetical Protein LOC55471 Isoform 1 ==
 
 
=== BLAST P ===
 
 
BLASTP results produced 47 multiple aligned sequences to the bacterial sequence of the 1ZKD protein.
The results are as follow [[BLASTP results]].
 
The highlighted sequences show the 1ZKD protein sequence data and the closest match or best aligned sequence (>gi|39937419|ref|NP_949695.1| DUF185 [Rhodopseudomonas palustris CGA009]).
 
 
=== Clustal X ===
 
 
The following are some ClustalX images that were produced.
 
[[Image:ClustalX omit.jpg|thumb|900px|Figure 15. Clustal X image of sequences that produce Gaps|center]]
 
 
[[Image:Clustal X.jpg|thumb|900px|Figure 16. Clustal X image of end region of MSA cluster|center]]
 
 
After running Clustal X many sequences were omitted as they created many gaps in the MSA multiple sequence alignment. In the process, all of the mouse and human comparative sequences were also omitted and this is visible in the evolutionary tree constructed at the end.
This however allowed the focus of the research into the evolutionary construct of the 1ZKD protein to be more specific in relation to other bacteria’s.
 
 
After carefully analyzing the MSA in a clustal X format, the closest available sequence to the protein sequence of 1ZKD was the DUF185 protein sequence from Rhodopseudomonas palustris bacteria. The only differences were the occurrence of '''eight different amino acids''' randomly in the sequence and the '''eight extra amino acids''' at the '3’' or the 'C-terminus' end of the 1ZKD amino acid sequence.
 
Our protein amino acid sequence is '''no. 32''' and the closest matched sequence is of DUF185 amino acid sequence is at '''no. 31'''.
 
=== Protdist ===
 
[[Protdist results]] and how it looks like.
 
The number at the top of the page indicates the number of sequences uploaded.
 
 
=== Bootstrap values for Bacterial Protein ===
 
 
[[Bootstrap values]]
 
The evolutionary tree obtained after bootstrapping. This view of the tree via the Treeview program allows for the analyzing of the the organisms that are in close sequence proximity as our sequence.
 
[[Image:Tree with names.jpg]]
 
 
 
 
=== Evolutionary Tree ===
 
[[Image:Tree wit bootstrap.JPG|900px]]
 
'''>>> Brown colored branches''' consists of organisms from a Bacterial lineage, and most of them happen to be gram-negative bacteria. Most of the bacteria’s in the branches seem to be from the alpha proteobacteria family. Some of bacteria also show similarities in their ability for nitrogen fixation namely Rhodopseudomonas  palustris, Bradyrhizobium japonicum, Agrobacterium tumefaciens and Azospirillum brasilense.
 
'''>>> Green colored branches''' consist of organisms from the Fungi kingdom, mostly found growing in the soil.
 
 
'''>>> Blue colored branches''' consist of organisms from the Plantae kingdom, some showing affinity to being associated with yeast.
 
'''>>> Red dots''' denote branches/lineages with bootstrap values of more than 75%, which signifies very high confidence on the branching of the organisms in the tree.
 


Gaps (average per molecule): 53.5


Sequence Identity: 14.4%


RMSD min – max: 3.03A






Return to [[Report on 1zkd]]
Return to [[Report on 1zkd]]
[[http://compbio.chemistry.uq.edu.au/mediawiki/index.php/Discussion_%281zkd%29 Discussion]]

Latest revision as of 03:34, 12 June 2007

Structure of Hypothetical Protein LOC55471 Isoform 1

Comparing Structure of Proteins

Dali Results

Dali shows a few proteins with similar structure to 1zkd. They are 2ex4 and 1im8 which shows the highest Z-value of 11.7 and 11.6 respectively. The higher the Z-value the more significant is the results. However, they are only 10-12% identical to the query protein. Nevertheless, these 2 proteins are used to compare with the query protein as these 10-12% identity may be at the binding site or ligand which will determine the functions. 2ex4 is a human methyltransferase with S-adenosylhomocysteine and 1im8 is found to be a methyltransferase with a bound S-adenosylhomocysteine from the crystal structure of YecO from Haemophilus influenzae (HI0319).


SUMMARY: PDB/chain identifiers and structural alignment statistics

NR. STRID1 STRID2  Z   RMSD LALI LSEQ2 %IDE REVERS PERMUT NFRAG TOPO PROTEIN
1:  3027-A 1zkd-A 56.8  0.0  349   349  100      0      0     1 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    duf185  (rhodops
2:  3027-A 2ex4-A 11.7  3.0  185   221   12      0      0    22 S    TRANSFERASE      adrenal gland protein ad-003    (homo sapien
3:  3027-A 1im8-A 11.6  3.2  178   225   10      0      0    18 S    TRANSFERASE     yeco (methyltransferase, hypothetical pro 4:  3027-A 2gb4-A 10.8  3.3  184   231   13      0      0    19 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
5:  3027-A 2fk7-A 10.7  3.8  186   277   14      0      0    19 S    TRANSFERASE      methoxy mycolic acid synthase 4         (mycobact
6:  3027-A 2ob1-A 10.2  3.9  196   319    9      0      0    23 S    TRANSFERASE      leucine carboxyl methyltransferase 1 (prot
7:  3027-A 2f8l-A 10.0  3.7  182   318    8      0      0    22 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    hypothetical pro
8:  3027-A 2avn-A 10.0  3.7  183   242   11      0      0    20 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    ubiquinoneMENAQU
9:  3027-A 2bzg-A  9.9  3.4  182   226   13      0      0    20 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
10: 3027-A 2aot-A  9.8  4.3  182   285   13      0      0    23 S    TRANSFERASE      histamine n-methyltransferase (hmt)     (homo

Alignment with Known Proteins

1zkd is an unknown protein, and by using proteins similar to it, the functions of this unknown protein can be predicted. With 2ex4 and 1im8 showed by Dali to be the most similar, other tools are used to determine the similarity. Combinatorial Extension Method is used. Below shows the sequence alignment and structure alignment of the unknown protein with the proteins obtained from dali:

2ex4

Alignment with 2ex4
1ZKD:A   24/25    WRYXELCLGHPEHGYYV--TRDPLGREGDFTTSPEISQXFGELLGLWSASVWKAAD-EPQ
2EX4:A   24/7     IEDEKQFYS----KAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKFLQRFLREGPNKTG
1ZKD:A   81/82    TLRLIEIGPGRGTXXADALRALRVLPILYQSLSVHLVEINPVLRQKQQTLLAGI-RNIHW
2EX4:A   80/64    TSCALDCGAGIGRITKRLLLPL--------FREVDMVDITEDFLVQAKTYLGEEGKRVRN
1ZKD:A  140/141   HD-----SFEDVPEGPAVILANEYFDVLPIHQAIKRETGWHERVIEIGASGELVFGVAAD
2EX4:A  132/116   YFCCGLQDFTPEPDSYDVIWIQWVIGHLT-------------------------------
1ZKD:A  195/196   PIPGFEALLPPLARLSPPGAVFEWRP--DTEILKIASRVRDQGGAALIIDYG--HLRSDV
2EX4:A  161/145   ------------------------DQHLAEFLRRCKGSL-RPNGIIVIKDNMAQE-----
1ZKD:A  251/252   GDTFQAIASHSYADPLQHPGRADLTAHV---DFDALGRAAESIGARAHGPVTQG
2EX4:A  191/175   GVILDD---------------VDSSVCRDLDVVRRIICSAG---LSLLAEERQE
Figure 3. Structure of 2ex4
Figure 4. Structure Alignment with 2ex4 (Blue:1zkd, Purple: 2ex4)

Alignment Length: 294

Gaps (average per molecule): 53.5

Sequence Identity: 14.4%

RMSD min – max: 3.03A













1im8

Alignment with 1im8
1ZKD:A   59/60    QXFGELLGLWSASVWKAADEPQTLRLIEIGPGRGTXXADALRALRVLPILYQSLSVHLVE
1IM8:A   42/40    SNIITAIGXLAERFV-----TADSNVYDLGCSRGAATLSARRNI-----NQPNVKIIGID
1ZKD:A  119/120   INPVLRQKQQTLLAGI---RNIHWHD--SFEDVPEGPAVILANEYFDVLPIHQAIKRETG
1IM8:A   92/90    NSQPXVERCRQHIAAYHSEIPVEILCNDIRHVEIKNASXVILNFTLQFLP----------
1ZKD:A  174/175   WHERVIEIGASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRP--DTEILKIASRV
1IM8:A  142/140   ---------------------------------------------PEDRIALLTKIYEGL
1ZKD:A  232/233   RDQG--GAALIIDYG
1IM8:A  157/155   ---NPNGVLVLSEKF
Figure 5. Structure of 1im8
Figure 6. Structure Alignment with 1im8(Blue:1zkd, Purple: 1im8)


Alignment Length: 195

Gaps (average per molecule): 38.5

Sequence Identity: 11%

RMSD min – max: 2.3A












Ligand and Binding Sites

Figure 7. Binding Sites

































Figure 8. Conserved regions





















Domain

InterPro Results

Left


Pfam Results

DUF185: domain 1 of 1, from 64 to 299: score 227.1, E = 3.9e-65

                  *->alArwllveykllgyPYadlnlvElGaGrGtaielmsdlLryiarlv
                     +l++w + ++k+ ++P   l+l E+G+GrGt   +m+d+Lr+  r+ 
      query    64    LLGLWSASVWKAADEP-QTLRLIEIGPGRGT---MMADALRA-LRVL 105  
                  PdvyartryylvEiSprLaarQketLapkvaplGhdskveieatdlsglv
                  P +y+ ++++lvEi+p L+++Q++ La                 ++  ++
      query   106 PILYQSLSVHLVEINPVLRQKQQTLLA-----------------GIR-NI 137  
                  rWhdasileedPdgvptvliaNEVlDalPHDlvrfdkrgggwyErhVlvd
                   Whd s +e++P+g p v++aNE +D lP  +++ +kr+ gw+Er V ++
      query   138 HWHD-S-FEDVPEG-PAVILANEYFDVLP--IHQAIKRETGWHER-V-IE 180  
                  ldgdfrlvysqeldplaglaltlreaaldPVKstkklvpsalskllpkll
                    + ++lv+++++dp  g+                            ++l
      query   181 IGASGELVFGVAADPIPGFEAL------------------------LPPL 206  
                  ppaeevgygtEvYsParllellqalaerLpahrGrlLaiDYGhlaseyyh
                   +   +g+++E+  P    e+l+++ +  +  +G++L+iDYGhl+s    
      query   207 ARLSPPGAVFEW-RPDT--EILKIASRVRD-QGGAALIIDYGHLRSD--- 249  
                  prrksalaaemfngtllqayrqhahddpltnpssllVlyStvaqGlaDiT
                               g+++qa+  h + dpl +p            G+aD+T
      query   250 ------------VGDTFQAIASHSYADPLQHP------------GRADLT 275  
                  ahVDFtalaradqyqtaakaagdlkvlgvet<-*
                  ahVDF+al       +aa  +g + + g+ t   
      query   276 AHVDFDALG------RAAESIG-ARAHGPVT    299

Domain DUF 185 has been identified by InterPro and Pfam as show above. In Pfam the E value of 3.9e-65 gives significant results showing that it is not by chance nor random that the match made was DUF185. DUF 185 belong to the family of RNA methyltransferase.

Function of Hypothetical Protein LOC55471 Isoform 1

ProFunc analysis reveals methyltransferase activity as the most likely biochemical function

By using ProFunc (Laskowski et al, 2005) the most likely biochemical function of the unknown bacterial Protein 1zkd was determined as Methyltransferase. Matching structures were determined by SSM Secondary Structure Matching (Krissinel & Henrick, 2004) showing possible matches with 9 Methyltransferases from both human and bacteria (Fig.9).


Figure 9. SSM results showing ten sequences with a sequences id around 20 % with higher matching folds.


Ligand Template Matches LIG (Laskowski et al, 2005) revealed a probable match with the Protein-l-isoaspartate o-methyltransferase 1dl5 (Fig.10).

Figure 10. LIG results support the hypothesis of 1zkd being a methyltransferase.


REV Reverse Template Matches (Laskowski et al, 2005) also showed probable matches for several methyltransferases (Fig.11).


Figure 11. REV results showing five probable matches, which are all methyl or dimethyltransferases.


Superfamily program searches against a library of Hidden Markov Models HMMs (Gough et al, 2001; Madera et al, 2004) derived from SCOP families revealed similarities to the superfamily S-Adenosylmethionine-dependent Methyltransferases (E-value 6.69e-06). No DNA binding motifs (helix-turn-helix) were found in the ProFunc search.

Genomic context of the 1izkd gene

Genomic context of 1zkd in the genome of Rhodopseudomonas palustris from the NCBI Entrez Gene database shows a genomic co-localisation with another transferase, an oxidase, a kinase and another hypothetical protein (Fig.12).


Figure 12. The RPA4359 gene of the protein 1zkd is co-located with an upstream prolipoprotein diacylglyceryl transferase gene (1gt) and downstream with a multicopper polyphenol oxidase (RPA4360), a ribose-phosphate pyrophosphokinase (ribP) and another hypothetical protein of unknown function gene (RPA4361).

Localisation of 1zkd orthologs in the cell

Nucleo (Nuclear Protein Localisation Prediction) predicted a chance of 0.07 for the mouse ortholog and a chance of 0.20 for the human ortholog of 1zkd to be located in the nucleus (Hawkins et al, 2006).

LOCATE data was available for the mouse ortholog showing that it is a soluble, non-secreted protein with higher scores for a localisation in mitochondria or the cytoplasm (Fink et al, 2006).


Expression profiles of mouse and human orthologs

Expression profile data of the mouse and human ortholog were suggested by analysis of EST counts from NCBI UniGene database (http://www.ncbi.nlm.nih.gov/sites/entrez?db=unigene). ESTs were found in diverse tissues including brain, liver, lung, muscle and endocrine system showing that the target protein is expressed in a wide range of different cells (Fig.13a,b).

Figure 13a. Expression profile of the mouse ortholog.
Figure 13b. Expression profile of the human ortholog.

Electrostatic properties of the 1zkd protein surface

Electrostatic properties and surface charges of 1zkd were modelled using Adaptive Poisson-Boltzmann Solver APBS (Baker et al, 2001) and visualisation was performed by using Pymol (http://www.pymol.org). According to the resulting model, the 1zkd protein got a mostly negatively charged surface (Fig.14a,b), indicating that interactions with the negatively charged backbone of nucleic acids are rather unlikely.

Figure 14a. Surface charges of 1zkd as a dimer. Red colour indicating negative charges, blue colour indicating positive charges.
Figure 14b. Surface Charges of Protein. Red colour indicating negative charges, blue colour indicating positive charges




















Evolution of Hypothetical Protein LOC55471 Isoform 1

BLAST P

BLASTP results produced 47 multiple aligned sequences to the bacterial sequence of the 1ZKD protein. The results are as follow BLASTP results.

The highlighted sequences show the 1ZKD protein sequence data and the closest match or best aligned sequence (>gi|39937419|ref|NP_949695.1| DUF185 [Rhodopseudomonas palustris CGA009]).


Clustal X

The following are some ClustalX images that were produced.

Figure 15. Clustal X image of sequences that produce Gaps


Figure 16. Clustal X image of end region of MSA cluster


After running Clustal X many sequences were omitted as they created many gaps in the MSA multiple sequence alignment. In the process, all of the mouse and human comparative sequences were also omitted and this is visible in the evolutionary tree constructed at the end. This however allowed the focus of the research into the evolutionary construct of the 1ZKD protein to be more specific in relation to other bacteria’s.


After carefully analyzing the MSA in a clustal X format, the closest available sequence to the protein sequence of 1ZKD was the DUF185 protein sequence from Rhodopseudomonas palustris bacteria. The only differences were the occurrence of eight different amino acids randomly in the sequence and the eight extra amino acids at the '3’' or the 'C-terminus' end of the 1ZKD amino acid sequence.

Our protein amino acid sequence is no. 32 and the closest matched sequence is of DUF185 amino acid sequence is at no. 31.

Protdist

Protdist results and how it looks like.

The number at the top of the page indicates the number of sequences uploaded.


Bootstrap values for Bacterial Protein

Bootstrap values

The evolutionary tree obtained after bootstrapping. This view of the tree via the Treeview program allows for the analyzing of the the organisms that are in close sequence proximity as our sequence.

Tree with names.jpg



Evolutionary Tree

Tree wit bootstrap.JPG

>>> Brown colored branches consists of organisms from a Bacterial lineage, and most of them happen to be gram-negative bacteria. Most of the bacteria’s in the branches seem to be from the alpha proteobacteria family. Some of bacteria also show similarities in their ability for nitrogen fixation namely Rhodopseudomonas palustris, Bradyrhizobium japonicum, Agrobacterium tumefaciens and Azospirillum brasilense.


>>> Green colored branches consist of organisms from the Fungi kingdom, mostly found growing in the soil.


>>> Blue colored branches consist of organisms from the Plantae kingdom, some showing affinity to being associated with yeast.


>>> Red dots denote branches/lineages with bootstrap values of more than 75%, which signifies very high confidence on the branching of the organisms in the tree.




Return to Report on 1zkd


[Discussion]