Structural analysis of 2qgn

General Properties of 2qgn

General information collected from PDB indicates that :

(a) 2qgn is a tRNA isopentenyl transferase isolated from Bacillus holodurans c-125, expressed in Escherichia Coli.

(b) Also known as tRNA delta(2)-isopentenylpyrophosphate transferase, belonging to the IPP transferase family

(c) Resolution of 2.4 angstroms, with an r-value of 0.225.

(d) Ligand chemical component identified as sulfate ion.

Protein Sequence in FASTA format

>gi|152149497|pdb|2QGN|A Chain A, Crystal Structure Of Trna Isopentenylpyrophosphate Transferase (Bh2366) From Bacillus Halodurans, Northeast Structural Genomics Consortium Target Bhr41. XKEKLVAIVGPTAVGKTKTSVXLAKRLNGEVISGDSXQVYRGXDIGTAKITAEEXDGVPHHLIDIKDPSE SFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALH DKLSKIDPKAAAAIHPNNYRRVIRALEIIKLTGKTVTEQARHEEETPSPYNLVXIGLTXERDVLYDRINR RVDQXVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEXYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRN KANVTWFDXTDVDFDKKIXEIHNFIAGKLEEKSKLEHHHHHH

Structure of Protein

Figure 1
Structure of tRNA isopentenyl transferase 1 showing helix, sheet and loop. Image constructed from PyMOL.

Secondary Structure and Location of P-loop (ATP binding site)

Analysis of the secondary structure acquired from Protein Data Bank showed results as displayed below :

P-loop region in the protein was found via a conserved GxTxxGK(T/S) motif, similar to the P-loop in kinases as well as other nucleotide binding proteins. From the secondary structure, the dots highlighted in red proposes the possible location of P-loop.

Surface Structure

Figure 1.1 Surface view of protein with ligand found in the cavitiy of the protein.

Electrostatic Surface Potential

Figure 1.2 Electrostatic surface potential of 2qgn. Positve regions indicated by blue, negatively charged in red.

Domains

2qgnA is composed of two main domains. CATH analysis of 2qgn resulted in the finding of two main domains composing 2qgnA.

Domain 1 ranges from residue 2-200 and residue 283-314. Domain 2 encompasses residues stretching from 201-282. Topology of Domain 1 is known to be of Rossmann A-B-A fold, and is a representative of the homologous superfamily of P-loop containing nucleotide triphosphate hydrolases. Domain 2 is yet to be classified.

Figure 4
Two main domains exhibited by tRNA isopentenyl transferase(2qgnA). Blue regions denote first domain while Red regions underlies second domain.

Figure 5Ribbon structure of domain 2 signified by red regions in Figure 4.

Figure 6Ribbon structure of domain 1 denoted by blue regions in Figure 4.

Surface Topography

Figure 3 Putative pocket in tRNA isopentenyl transferase. A total of 19 pockets were found in 2qgnA, displayed in green is the pocket with the largest area and volume.

Ligand Binding Sites and Surface Clefts

LIGPLOT of protein shows protein-ligand interaction. The interactions shown are those mediated by hydrogen bonds and by

hydrophobic contacts. Hydrogen bonds indicated by dashed lines between the atoms involved, while hydrophobic contacts are

represented by an arc with spokes radiating towards the ligand atoms they contact. The contacted atoms are shown with spokes

radiating back.

Protein-ligand interaction

Hydrophillic binding sites

File:Hydrophillic.jpg

Bridged-H-bond binding sites

File:H-bond.jpg

Hydrophobic binding sites

File:Hydrophobic.jpg

Conserved residues from Clustal alignment

Multiple sequence alignment from ClustalX allowed conserved regions in 2qgn and related species to be found.

Figure 5 Conserved regions among various species were shown in red, with their respective residues labelled. Yellow sphere shows the location of the ligand. Image was constructed from PyMOL.

Structural Alignment

Dali Output

PDB entry code for 2qgn was loaded onto DALI server to search for structurally similar neighbours. Displayed below are the results from DALI search :-

DALI output describes the following :

Z score , the statistical significance of the similarity between protein-of-interest and other neighbourhood protines. The program optimises a weighted sum of similarities of intramolecular distances.

Root Mean Square Distance (RMSD), root-mean-square deviation of C-alpha atoms in the least-squares superimposition of the structurally equivalent C-alpha atoms. As in indicated in DALI, rmsd is not optimised and is only reported for information.

lali, the number of structurally equivalent residues.

nres, or the total number of amino acids in the hit protein.

%id - percentage of identical amino acids over structurally equivalent residues.

A total of 527 hits were found from DALI search, nonetheless only the first 20 hits that may be of significance were shown on the figure.

Profunc

Related protein sequences

Proteins with similar fold retrived from SSM (Secondary Structure Matching)

From Profunc, similarities of related proteins and proteins with similar fold to query protein were compared with results from DALI. 2qgnA is the query protein highlighted in black in all tables. 2crm, 2crr and 2crq were both found in DALI and Profunc(highlighted in red). On the other hand, 2ze5,2ze6,2ze7 and 2ze8, as well as 3adk and 2qor were also found in DALI output(highlighted in blue).

Based on the outcome of DALI and Profunc, PDB files of each structurally similar protein was obtained from PDB. These were each superimposed against 2qgn using the PyMOL software, to compare the structural similiarity. Results are as below :

Figure 7 3crq superimposed against 2qgn via PyMOL. 2qgn indicated in green.

Figure 8 3crm superimposed against 2qgn via PyMOL. 2qgn indicated in green.

Figure 9 2ze7 superimposed against 2qgn via PyMOL. 2qgn indicated in green.

Figure 10 2qor superimposed against 2qgn via PyMOL. 2qgn indicated in green

As indicated by the figures above, each structures were structurally similar to 2qgn, suggesting that they could have functionally similar properties. Nonetheless,notice that 2-qor is only partially similar to 2qgn structure.

As the Z-score decreases for the DALI output, the structural similarity decreases as well. For this reason, functional analysis of 2qgn was only done for DALI outputs with lali scores higher than 200.