|
|
Line 1: |
Line 1: |
| Content-type: text/html
| | [[C:\Documents and Settings\s4123252\Desktop\1zkd BLOCKS Result.html]] |
| Block Searcher Results
| |
| Go to hits
| |
| Introduction
| |
| | |
| BLKPROB Version 12/23/06.1
| |
| Database=../data-blplus-minus/blocks.dat
| |
| ___________ ___________ ___________
| |
| |\ __________\ |___________| /__________ /|
| |
| | | | | | | | |
| |
| | | **********| |***********| |********** | |
| |
| | | * BLOCKS | | WWW | |SEARCHER * | |
| |
| | | **********| |***********| |********** | |
| |
| \|___________|___________|___________|___________|___________|/
| |
| |\ __________\ /__________ /|
| |
| | | | | http:// | |
| |
| | | | | blocks. | |
| |
| | | | | fhcrc. | |
| |
| | | | | org | |
| |
| \|___________| |___________|/
| |
| | |
| | |
| Here are your search results. The database searched was BLOCKS 14.3 (Apr 2007)
| |
| consisting of 27,288 blocks representing 5635 nonredundant entries documented
| |
| in InterPro 14.0 keyed to Swiss-Prot 51.3 and TrEMBL 34.3.
| |
| If you found the Blocks Searcher useful, please cite:
| |
| S Henikoff & JG Henikoff, "Protein family classification
| |
| based on searching a database of blocks", Genomics 19:97-107 (1994).
| |
| Please report problems at: http://blocks.fhcrc.org/contact.html
| |
| ==============================================================================
| |
| Each numbered result consists of one or more blocks from a Prosite group found
| |
| in the query sequence. One set of the highest-scoring blocks that are in the
| |
| correct order and separated by distances comparable to the Blocks database is
| |
| selected for analysis. If this set includes multiple blocks the probability
| |
| that the lower scoring blocks support the highest scoring block is reported.
| |
| Maps of the database blocks and query sequence are shown:
| |
| AAA represents the first block roughly in proportion to its width.
| |
| : represents the minimum distance between blocks in the database.
| |
| . represents the maximum distance between blocks in the database.
| |
| < > indicate the sequence has been truncated to fit the page.
| |
| The query map is aligned on the highest scoring block. Multiple block hits
| |
| that are consistent with the highest scoring block are separated by colons.
| |
| Block hits that are not consistent are mapped below. The alignment of the
| |
| query sequence with the sequence closest to it in the BLOCKS database is
| |
| shown. The distance between detected blocks is listed as (min, max): for the
| |
| database entry followed by the distance in the query. Upper case in the query
| |
| indicates at least one occurrence of the residue in that column of the block.
| |
| | |
| For interpretation of block hits, you might find it worthwhile to obtain the
| |
| full set of blocks and documentation for a group. To do this, send a blank
| |
| message to blocks@blocks.fhcrc.org with the subject heading: GET BL????? e.g.,
| |
| 'Subject: GET BL00044' (0s are zeros) for full information on this group.
| |
| =============================================================================
| |
| Note: For searches using DNA queries, "Location" refers to the position
| |
| in the query in base pairs from 5' to 3' on the + strand, whereas the map and
| |
| alignment show the translated position in amino acid residues as before.
| |
| =============================================================================
| |
| | |
| | |
| [Return to top]
| |
| | |
| Hits
| |
| Query=Unknown Unknown
| |
| Size=441 Amino Acids
| |
| Blocks Searched=27288
| |
| Alignments Done= 12745007
| |
| Cutoff combined expected value for hits= 1
| |
| Cutoff block expected value for repeats/other= 1
| |
| ==============================================================================
| |
| Combined
| |
| Family Strand Blocks E-value
| |
| IPB001944 Glycoside hydrolase, family 35 1 1 of 8 0.052
| |
| | |
| ==============================================================================
| |
| >IPB001944 1/8 blocks Combined E-value= 0.052: Glycoside hydrolase, family 35
| |
| Block Frame Location (aa) Block E-value
| |
| IPB001944A 0 23-77 0.049
| |
| Other reported alignments:
| |
| | |
| |--- 599 amino acids---|
| |
| IPB001944 AAB..C::::...D.E:.............F............G................H
| |
| Unknown AA
| |
| | |
| IPB001944A <->A (-28,146):22
| |
| Q4WG05|Q4WG05_ASPFU53 GERLMIFSGEFHPFRLPVPGLWFDVFQKIKSLGFNAVSFYTDWGLMEGNPGHVVT
| |
| | || | || |||| | | | | | |
| |
| Unknown 23 iwRGKYFSSGnePaenPVTPMlRHLMYKIKSTGpiTVAeYmkevLtNPAKGYYVY
| |
| | |
| ------------------------------------------------------------------------------
| |
| | |
| 1 possible hits reported
| |
| | |
| [Return to top] [Blocks Home]
| |