Methods for evolutionary analysis
The methods employed to obtain evolutionary data on selenium binding protein 2ece
The aim to the evolutionary analysis is to find and categorize similar proteins to hint towards the proteins likely function and role, as well as giving solid evidence to base our conclusions on. A series of steps were taken in order to accomplish this goal, these are listed below.
Psi Blast
The amino acid sequence of 2ece was put into a psi blast program using a non redundant database of proteins both the program and database was on the dvd. The amino acid sequence is below
MAIVPFKRDPTFYPSPKMAMKAPPEDLAYVACLYTGTGINRADFIAVVDVNPKSETYSKIVHKVELPYINDELHHFGWNA CSSALCPNGKPNIERRFLIVPGLRSSRIYIIDTKPNPREPKIIKVIEPEEVKKVSGYSRLHTVHCGPDAIYISALGNEEG EGPGGILMLDHYSFEPLGKWEIDRGDQYLAYDFWWNLPNEVLVSSEWAVPNTIEDGLKLEHLKDRYGNRIHFWDLRKRKR IHSLTLGEENRMALELRPLHDPTKLMGFINMVVSLKDLSSSIWLWFYEDGKWNAEKVIEIPAEPLEGNLPEILKPFKAVP PLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKVKLGGIFHRADHPAGHKLTGAPQMLEISRDGRRVYVTNS LYSTWDNQFYPEGLKGWMVKLNANPSGGLEIDKEFFVDFGEARSHQVRLSGGDASSDSYCYP
The output blast file from the psi blast program can be found here Media:blast.txt