Bifunctional coenzyme A synthase (CoA synthase) Structure Main
Coenzyme A Synthase PHD Functional Site Prediction
Pattern-ID: ASN_GLYCOSYLATION PS00001 PDOC00001 Pattern-DE: N-glycosylation site Pattern: N[^P][ST][^P] 34 NHTL
Pattern-ID: GLYCOSAMINOGLYCAN PS00002 PDOC00002 Pattern-DE: Glycosaminoglycan attachment site Pattern: SG.G 367 SGSG
Pattern-ID: PKC_PHOSPHO_SITE PS00005 PDOC00005 Pattern-DE: Protein kinase C phosphorylation site Pattern: [ST].[RK] 173 TIR 183 SPK 245 TER 291 TYR 335 SFR 369 SGK 541 TQR
Pattern-ID: CK2_PHOSPHO_SITE PS00006 PDOC00006 Pattern-DE: Casein kinase II phosphorylation site Pattern: [ST].{2}[DE] 324 TENE 534 TLWE
Pattern-ID: MYRISTYL PS00008 PDOC00008 Pattern-DE: N-myristoylation site Pattern: G[^EDRKHPFYW].{2}[STAGCN][^P] 194 GAVGGT 277 GSDPSL 295 GMAINR 365 GISGSG 505 GLSEAA
Pattern-ID: AMIDATION PS00009 PDOC00009 Pattern-DE: Amidation site Pattern: .G[RK][RK] 462 EGKR
Pattern-ID: ATP_GTP_A PS00017 PDOC00017 Pattern-DE: ATP/GTP-binding site motif A (P-loop) Pattern: [AG].{4}GK[ST] 365 GISGSGKS
Pattern-ID: UPF0038 PS01294 PDOC00996 Pattern-DE: Uncharacterized protein family UPF0038 signature Pattern: G.[LI].R.{2}L.{4}F.{8}[LIV].{5}P.[LIV] 419 GIINRKVLGSRVFGNKKQLKILTDIMWPII
Coenzyme A Atomic structures:
Coenzyme A Synthase atomic structure by bfactor (flexibility as denoted by crystalography; red is more flexible, blue is more structurally stable)
Coenzyme A Synthase atomic structure
Coenzyme A Synthase Ribbon structures:
Coenzyme A ribbon structure with water molecules
Coenzyme A Synthase ribbon structure by hydrophobicity
Coenzyme A Synthase ribbon structure by compound type
Coenzyme A Synthase ribbon structure by conformation/structural type
Binding Sites and types for AcetylCoenzymeA ligand to CoenzymeA Synthase:
Binding Sites and types for unknown ligand UNL to CoenzymeA Synthase:
Highly Structurally Related Proteins:
Thymidylate Kinase: Nucleoside monophosphate kinase. Catalyses reversible phosphorylation transfer between ATP & TMP > ADP & TDP. Activates Anti HIV prodrugs.
Shikimate Kinase: Target for nontoxic antimicrobial agents, herbicides and parasite drugs. Absent in mammals. Catalyses reaction of phosphoryltransfer from ATP to shikimic acid.
Adenylate Kinase: Nucleoside monophosphate kinase. Essential for bacterial survival. AMP(bd) domain close to core of structure. Low catalytic activity compared to eukaryotic kinases (10 fold slower).
Dephospho-COA Kinase: Uses ATP as phosphate donor in phosphorylation of 3-hydroxy group of ribose (final stages of biosynthesis). ATP binds in p-loop (as it does in other kinases). COA binding site located at join of all 3 domains.
UMP/CMP kinase: Supplies precursors for nucleic acid synthesis. Catalyses UMP,CMP & dCMP into diphosphate form. Component of nucleoside analog prodrugs (AraC, gemcitabine & ddC).
Uridine-Cystidine Kinase: Catalyses phosphorylation of uridine & cystidine. Upon cystidine binding UCK becomes strictly specific to pyramidine ribnucleotides.