1zkd BLOCKS Result.html
Content-type: text/html Block Searcher Results Go to hits Introduction
BLKPROB Version 12/23/06.1 Database=../data-blplus-minus/blocks.dat
___________ ___________ ___________
|\ __________\ |___________| /__________ /|
| | | | | | | |
| | **********| |***********| |********** | |
| | * BLOCKS | | WWW | |SEARCHER * | |
| | **********| |***********| |********** | |
\|___________|___________|___________|___________|___________|/
|\ __________\ /__________ /|
| | | | http:// | |
| | | | blocks. | |
| | | | fhcrc. | |
| | | | org | |
\|___________| |___________|/
Here are your search results. The database searched was BLOCKS 14.3 (Apr 2007)
consisting of 27,288 blocks representing 5635 nonredundant entries documented
in InterPro 14.0 keyed to Swiss-Prot 51.3 and TrEMBL 34.3.
If you found the Blocks Searcher useful, please cite:
S Henikoff & JG Henikoff, "Protein family classification based on searching a database of blocks", Genomics 19:97-107 (1994).
Please report problems at: http://blocks.fhcrc.org/contact.html
==================================================================
Each numbered result consists of one or more blocks from a Prosite group found in the query sequence. One set of the highest-scoring blocks that are in the correct order and separated by distances comparable to the Blocks database is selected for analysis. If this set includes multiple blocks the probability that the lower scoring blocks support the highest scoring block is reported. Maps of the database blocks and query sequence are shown: AAA represents the first block roughly in proportion to its width.
: represents the minimum distance between blocks in the database. . represents the maximum distance between blocks in the database.
< > indicate the sequence has been truncated to fit the page. The query map is aligned on the highest scoring block. Multiple block hits that are consistent with the highest scoring block are separated by colons. Block hits that are not consistent are mapped below. The alignment of the query sequence with the sequence closest to it in the BLOCKS database is shown. The distance between detected blocks is listed as (min, max): for the database entry followed by the distance in the query. Upper case in the query indicates at least one occurrence of the residue in that column of the block.
For interpretation of block hits, you might find it worthwhile to obtain the full set of blocks and documentation for a group. To do this, send a blank message to blocks@blocks.fhcrc.org with the subject heading: GET BL????? e.g., 'Subject: GET BL00044' (0s are zeros) for full information on this group.
=================================================================
Note: For searches using DNA queries, "Location" refers to the position in the query in base pairs from 5' to 3' on the + strand, whereas the map and alignment show the translated position in amino acid residues as before.
=================================================================
[Return to top]
Hits Query=Unknown Unknown Size=441 Amino Acids Blocks Searched=27288 Alignments Done= 12745007 Cutoff combined expected value for hits= 1 Cutoff block expected value for repeats/other= 1
==================================================================
Combined
Family Strand Blocks E-value IPB001944 Glycoside hydrolase, family 35 1 1 of 8 0.052
==================================================================
>IPB001944 1/8 blocks Combined E-value= 0.052: Glycoside hydrolase, family 35 Block Frame Location (aa) Block E-value IPB001944A 0 23-77 0.049 Other reported alignments:
|--- 599 amino acids---|
IPB001944 AAB..C::::...D.E:.............F............G................H
Unknown AA
IPB001944A <->A (-28,146):22 Q4WG05|Q4WG05_ASPFU53 GERLMIFSGEFHPFRLPVPGLWFDVFQKIKSLGFNAVSFYTDWGLMEGNPGHVVT
| || | || |||| | | | | | |
Unknown 23 iwRGKYFSSGnePaenPVTPMlRHLMYKIKSTGpiTVAeYmkevLtNPAKGYYVY
1 possible hits reported
[Return to top] [Blocks Home]
