Arylformamidase: Difference between revisions

From MDWiki
Jump to navigationJump to search
No edit summary
 
(43 intermediate revisions by 4 users not shown)
Line 1: Line 1:
== Menu ==
[[Image:Pretty protein.PNG|centre|framed|'''Figure 1.''' ''2PBL'']]


''by Basma Al Alaiwat, Sebastian Mynott and Thomas Parker''


== Abstract ==


2PBL, initially annotated as an arylformamidase, was isolated from ''Silicibacter sp. TM1040'' and its structure determined by the JCSG. Based on structural, functional and evolutionary analysis, we have further characterised 2PBL. It was found to contain a conserved functional region present in A/B-hydrolases of many taxonomic groups. Specifically, it was found to share similar structural and sequence characteristics of the prokaryotic HSL family of esterases. Residues of a probable catalytic triad were identified as Ser137, His242 and Glu215. Further experimental characterisation of 2PBL is required to better understand its function.


== Contents ==


[[Arylformamidase Sequence & Homology | Sequence & Homology]] - ''Sebastian Mynott''
[[Arylformamidase Introduction|Introduction]]  


[[Arylformamidase Structure | Structure]] - ''Basma Al Alaiwat''
[[Arylformamidase Results|Results]]  


[[Arylformamidase Function | Function]] - ''Thomas Parker''
[[Arylformamidase Discussion|Discussion]]


== Putative Synonyms ==
[[Arylformamidase Methods|Methods]]


Kynurenine formamidase
[[Arylformamidase Additional Materials|Additional Materials]]


== FASTA Sequence ==
[[Arylformamidase References|References]]


>gi|146387357|pdb|2PBL|A Chain A, Crystal Structure Of Putative Thioesterase (Yp_614486.1) From Silicibacter Sp. Tm1040 At 1.79 A Resolution
== Presentations ==
GXELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDLFLPEGTPVGLFVFVH
GGYWXAFDKSSWSHLAVGALSKGWAVAXPSYELCPEVRISEITQQISQAVTAAAKEIDGPIVLAGHSAGG
HLVARXLDPEVLPEAVGARIRNVVPISPLSDLRPLLRTSXNEKFKXDADAAIAESPVEXQNRYDAKVTVW
VGGAERPAFLDQAIWLVEAWDADHVIAFEKHHFNVIEPLADPESDLVAVITA


== Literature ==
[[Arylformamidase Sequence & Homology | Sequence & Homology]] - ''Sebastian Mynott''


''Pabarcus MK, Casida JE.''
[[Arylformamidase Structure | Structure]] - ''Basma Al Alaiwat''
'''[http://www.ncbi.nlm.nih.gov/pubmed/15935693?ordinalpos=1&itool=EntrezSystem2.PEntrez.Pubmed.Pubmed_ResultsPanel.Pubmed_RVDocSum Cloning, expression, and catalytic triad of recombinant arylformamidase.]'''
Protein Expr Purif. Nov;44(1):39-44.
 
''De Simone G, Menchise V, Manco G, Mandrich L, Sorrentino N, Lang D, Rossi M, Pedone C.''
'''[http://www.ncbi.nlm.nih.gov/pubmed/11846563?ordinalpos=1&itool=EntrezSystem2.PEntrez.Pubmed.Pubmed_ResultsPanel.Pubmed_RVDocSum The crystal structure of a hyper-thermophilic carboxylesterase from the archaeon Archaeoglobus fulgidus.]'''
J Mol Biol. 2001 Nov 30;314(3):507-18.


2-''Effect of arylformamidase (kynurenine formamidase) gene inactivation in mice on enzymatic activity, kynurenine pathway metabolites and phenotype''
[[Arylformamidase Function Slide 1 | Function]] - ''Thomas Parker''
  http://www.ncbi.nlm.nih.gov/pubmed/12007602?ordinalpos=1&itool=EntrezSystem2.PEntrez.Pubmed.Pubmed_ResultsPanel.Pubmed_DiscoveryPanel.Pubmed_Discovery_RA&linkpos=2&log$=relatedarticles&dbfrom=pubmed

Latest revision as of 03:29, 10 June 2008

Figure 1. 2PBL

by Basma Al Alaiwat, Sebastian Mynott and Thomas Parker

Abstract

2PBL, initially annotated as an arylformamidase, was isolated from Silicibacter sp. TM1040 and its structure determined by the JCSG. Based on structural, functional and evolutionary analysis, we have further characterised 2PBL. It was found to contain a conserved functional region present in A/B-hydrolases of many taxonomic groups. Specifically, it was found to share similar structural and sequence characteristics of the prokaryotic HSL family of esterases. Residues of a probable catalytic triad were identified as Ser137, His242 and Glu215. Further experimental characterisation of 2PBL is required to better understand its function.

Contents

Introduction

Results

Discussion

Methods

Additional Materials

References

Presentations

Sequence & Homology - Sebastian Mynott

Structure - Basma Al Alaiwat

Function - Thomas Parker

Retrieved from "http://compbio.biosci.uq.edu.au/mediawiki/index.php?title=Arylformamidase&oldid=10839"