Gaf Domain on C-Terminal: Difference between revisions
From MDWiki
Jump to navigationJump to search
No edit summary |
No edit summary |
||
| Line 1: | Line 1: | ||
<pre> | |||
USR1:_(size=344) vs USR2:A(size=180) | USR1:_(size=344) vs USR2:A(size=180) | ||
Structure Alignment Rmsd = 3.3Å Z-Score = 4.4 | Structure Alignment Rmsd = 3.3Å Z-Score = 4.4 | ||
| Line 36: | Line 37: | ||
View of structure alignment using Protein Explorer | View of structure alignment using Protein Explorer | ||
</pre> | |||
Latest revision as of 06:32, 15 May 2007
USR1:_(size=344) vs USR2:A(size=180) Structure Alignment Rmsd = 3.3Å Z-Score = 4.4 Sequence identity = 6.8% Aligned/gap positions = 117/76 Sequence alignment based on structure alignment. Sequence alignment based on structure alignment. Position numbers according to sequence (starting from 1) and according to PDB are given as SSSS/PPPP, SSSS - sequence, PPPP - PDB. USR1:_ - USR2:A - MOL_ID: 1; MOLECULE: GAF; CHAIN: A, B; ENGINEERED: YES USR1:_ 162/163 TMLLAKFSFYFHEALSRQTTASEMKALTAKANPDLFGKISSFIRK--YDAANVSLIFDN- USR2:A 36/37 SDGQVNWVCNLS---------------------NASSLIWHAYKSLAVDINWAGFYVTQA USR1:_ 219/220 -RGSESFQGHGYHHPHSYREAPKGVDQYPAVVSLPSDRPVMHW----PNVIMIMTDRASD USR2:A 75/76 SEEN----------------------TLILGPFQGKVACQ--MIQFGKGVCGTAASTK-- USR1:_ 274/275 LNSLEKVVHFYDDKV----------QSTYFLTRPEP-----HFTIVVIFESKKSERDSHF USR2:A 109/110 -----ETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHV-D USR1:_ 319/320 ISFLNELSLALKN USR2:A 163/164 KEFLEKLAKLINK View Results: Download alignment as a PDB file Quick view of structure alignment (using Rasmol) Detailed analysis of alignment (using Compare3D Java applet) Notes: (i) On some platforms (IntermnetExplorer7) Compare3D starts from the second click (ii) Compare3D may not work with some versions of InternetExplorer or across the firewall View of structure alignment using Protein Explorer
