Structural analysis of 2ece: Difference between revisions

From MDWiki
Jump to navigationJump to search
No edit summary
 
(One intermediate revision by the same user not shown)
Line 13: Line 13:




[[Image:PBB_GE_SELENBP1_214433_s_at_fs.png|frame|border|center|Gene expression of the SELENBP1 gene based on gene atlas of the mouse and human protein -encoding transcriptomes-proc. Natl. Ac. Sci. 101 (16) 6062-7]]
[[Image:PBB_GE_SELENBP1_214433_s_at_fs.png|frame|border|center|'''Figure 2.1'''Gene expression of the SELENBP1 gene based on gene atlas of the mouse and human protein -encoding transcriptomes-proc. Natl. Ac. Sci. 101 (16) 6062-7]]




[[Image:2ece_bio_r_500structure.jpg|frame|border|left|'''Figure 1''' X-ray structure of hypothetical selenium-binding protein from ''Sulfolobus tokodaii'', ST0059 ( http://www.proteopedia.org/wiki/index.php/2ece ) and the JenaLib Jmol viewer showing SBP 1 secondary structure spinning [http://www.imb-jena.de/cgi-bin/3d_mapping.pl?CODE=2ece&MODE=asymmetric]]
[[Image:2ece_bio_r_500structure.jpg|frame|border|left|'''Figure 2.2''' X-ray structure of hypothetical selenium-binding protein from ''Sulfolobus tokodaii'', ST0059 ( http://www.proteopedia.org/wiki/index.php/2ece ) and the JenaLib Jmol viewer showing SBP 1 secondary structure spinning [http://www.imb-jena.de/cgi-bin/3d_mapping.pl?CODE=2ece&MODE=asymmetric]]




Line 23: Line 23:




[[Image:SABLE.gif|frame|border|left|'''Figure 2''' SBP amino acid structure prediction derived from the SABLE server prediction- '''Query name''': SBP 1 ( 2ECE )
[[Image:SABLE.gif|frame|border|left|'''Figure 2.3''' SBP amino acid structure prediction derived from the SABLE server prediction- '''Query name''': SBP 1 ( 2ECE )
Structure prediction by SABLE
Structure prediction by SABLE


Line 74: Line 74:
       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
       NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN


'''Figure 3''' SABLE server results.
'''Figure 2.4''' SABLE server results.


   
   




[[Image:movie0001.png|frame|border|left|'''Figure 4''' Shows structural helices(red) and beta sheets (yellow) of SBP designed from pymol
[[Image:movie0001.png|frame|border|left|'''Figure 2.5''' Shows structural helices(red) and beta sheets (yellow) of SBP designed from pymol


]]
]]




[[Image:secondary structure.gif|frame|border|left|'''Figure 5'''  PDBsum of structural representation of SELENBP1 showing disulphide bonds networks (yellow), loops, helices (labelled blue) and beta sheets ( labelled Red)]]
[[Image:secondary structure.gif|frame|border|left|'''Figure 2.6'''  PDBsum of structural representation of SELENBP1 showing disulphide bonds networks (yellow), loops, helices (labelled blue) and beta sheets ( labelled Red)]]








[[Image:pdb_cartoon_2ece.png|frame|border|left|'''Figure 6''' PDBsum shows the beta and a- helices of SELENBP1 ]]
[[Image:pdb_cartoon_2ece.png|frame|border|left|'''Figure 2.7''' PDBsum shows the beta and a- helices of SELENBP1 ]]


[[Image:topology of 2ece.gif|frame|border|left|'''Figure 2.8''' topology of SBP]]




Line 200: Line 202:
STRUCTURAL COMPARISONS
STRUCTURAL COMPARISONS


[[Image:surface of 2ece.png|frame|border|left|'''Figure 7''' Surface Structure of SBP: Note the few clefts compared to the DNA isomerase shown below.]]
[[Image:surface of 2ece.png|frame|border|left|'''Figure 2.8''' Surface Structure of SBP: Note the few clefts compared to the DNA isomerase shown below.]]








[[Image:1YUA SURFACE STRUCTURE.JPG|frame|border|left|'''Figure 8''' pdb (1yua)-Topo-Zn DNA isomerase surface structure[http://www.ncbi.nlm.nih.gov/entrez/query/static/gifs/entrez_struc.gif] ]]
[[Image:1YUA SURFACE STRUCTURE.JPG|frame|border|left|'''Figure 2.9''' pdb (1yua)-Topo-Zn DNA isomerase surface structure[http://www.ncbi.nlm.nih.gov/entrez/query/static/gifs/entrez_struc.gif] ]]






[[Image:Rat fatty acid binding protein 2IFB.jpg|frame|border|left|'''Figure 9''' Rat fatty acid binding protein 2IFB, a was found to have 92.5% homology to 14 KDa Selenium binding protein purified from rat liver using column chromatography and SDS-Gel techniques.([[http://compbio.chemistry.uq.edu.au/mediawiki/index.php/References_2ece ref 3]])]]
[[Image:Rat fatty acid binding protein 2IFB.jpg|frame|border|left|'''Figure 2.10''' Rat fatty acid binding protein 2IFB, a was found to have 92.5% homology to 14 KDa Selenium binding protein purified from rat liver using column chromatography and SDS-Gel techniques.([[http://compbio.chemistry.uq.edu.au/mediawiki/index.php/References_2ece ref 3]])]]




Line 271: Line 273:


Explore SBP features and structural summary here [http://www.ncbi.nlm.nih.gov/Structure/mmdb/mmdbsrv.cgi?uid=61601].The domains of SBP are shown here [http://www.ncbi.nlm.nih.gov/sites/entrez?db=domains&cmd=search&term=2ece]
Explore SBP features and structural summary here [http://www.ncbi.nlm.nih.gov/Structure/mmdb/mmdbsrv.cgi?uid=61601].The domains of SBP are shown here [http://www.ncbi.nlm.nih.gov/sites/entrez?db=domains&cmd=search&term=2ece]
Notice how the domains are similar to the putative Isomerase domains of E.coli on '''Figure 10'''below.
Notice how the domains are similar to the putative Isomerase domains of E.coli on '''Figure 2.11'''below.




Line 319: Line 321:




[[Image:Ligand of bovine.png|frame|left|'''Figure 11'''Complex Of Bovine Odorant Binding Protein (Obp) With A Selenium Containing Odorant)"Image:Ligand of bovine.png" [[http://compbio.chemistry.uq.edu.au/mediawiki/upload/2/23/Ligand_of_bovine.png]]]]
[[Image:Ligand of bovine.png|frame|left|'''Figure 2.12'''Complex Of Bovine Odorant Binding Protein (Obp) With A Selenium Containing Odorant)"Image:Ligand of bovine.png" [[http://compbio.chemistry.uq.edu.au/mediawiki/upload/2/23/Ligand_of_bovine.png]]]]





Latest revision as of 08:38, 10 June 2008

STRUCTURAL ANALYSIS

SBP 1 Amino Acid FASTA FORMAT Sequence

>2ECE:A|PDBID|CHAIN|SEQUENCE

MAIVPFKRDPTFYPSPKMAMKAPPEDLAYVACLYTGTGINRADFIAVVDVNPKSETYSKIVHKVELPYINDELHHFGWNA CSSALCPNGKPNIERRFLIVPGLRSSRIYIIDTKPNPREPKIIKVIEPEEVKKVSGYSRLHTVHCGPDAIYISALGNEEG EGPGGILMLDHYSFEPLGKWEIDRGDQYLAYDFWWNLPNEVLVSSEWAVPNTIEDGLKLEHLKDRYGNRIHFWDLRKRKR IHSLTLGEENRMALELRPLHDPTKLMGFINMVVSLKDLSSSIWLWFYEDGKWNAEKVIEIPAEPLEGNLPEILKPFKAVP PLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTGKVKLGGIFHRADHPAGHKLTGAPQMLEISRDGRRVYVTNS LYSTWDNQFYPEGLKGWMVKLNANPSGGLEIDKEFFVDFGEARSHQVRLSGGDASSDSYCYP


Figure 2.1Gene expression of the SELENBP1 gene based on gene atlas of the mouse and human protein -encoding transcriptomes-proc. Natl. Ac. Sci. 101 (16) 6062-7


Figure 2.2 X-ray structure of hypothetical selenium-binding protein from Sulfolobus tokodaii, ST0059 ( http://www.proteopedia.org/wiki/index.php/2ece ) and the JenaLib Jmol viewer showing SBP 1 secondary structure spinning [http://www.imb-jena.de/cgi-bin/3d_mapping.pl?CODE=2ece&MODE=asymmetric




Figure 2.3 SBP amino acid structure prediction derived from the SABLE server prediction- Query name: SBP 1 ( 2ECE ) Structure prediction by SABLE Data source: Derived from the SABLE server prediction




WARNING! Given sequence appeared to be a soluble protein, no TM domains found!

Output format is the following:

1st line -> residue numeration

2nd line -> query amino acid sequence

3rd line -> trans-membrane domain prediction (T-TM region, N-soluble part)



     MAIVPFKRDPTFYPSPKMAMKAPPEDLAYVACLYTGTGINRADFIAVVDVNPKSETYSKI
    NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                           
     VHKVELPYINDELHHFGWNACSSALCPNGKPNIERRFLIVPGLRSSRIYIIDTKPNPREP
     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                             
     KIIKVIEPEEVKKVSGYSRLHTVHCGPDAIYISALGNEEGEGPGGILMLDHYSFEPLGKW
     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                      
     EIDRGDQYLAYDFWWNLPNEVLVSSEWAVPNTIEDGLKLEHLKDRYGNRIHFWDLRKRKR
     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                       
     IHSLTLGEENRMALELRPLHDPTKLMGFINMVVSLKDLSSSIWLWFYEDGKWNAEKVIEI
     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                      
     PAEPLEGNLPEILKPFKAVPPLVTDIDISLDDKFLYLSLWGIGEVRQYDISNPFKPVLTG
     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                                     
     KVKLGGIFHRADHPAGHKLTGAPQMLEISRDGRRVYVTNSLYSTWDNQFYPEGLKGWMVK
     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
                                  
     LNANPSGGLEIDKEFFVDFGEARSHQVRLSGGDASSDSYCYP
     NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN

Figure 2.4 SABLE server results.



Figure 2.5 Shows structural helices(red) and beta sheets (yellow) of SBP designed from pymol


Figure 2.6 PDBsum of structural representation of SELENBP1 showing disulphide bonds networks (yellow), loops, helices (labelled blue) and beta sheets ( labelled Red)



Figure 2.7 PDBsum shows the beta and a- helices of SELENBP1


Figure 2.8 topology of SBP






















































STRUCTURAL COMPARISONS

Figure 2.8 Surface Structure of SBP: Note the few clefts compared to the DNA isomerase shown below.



Figure 2.9 pdb (1yua)-Topo-Zn DNA isomerase surface structure[1]


Figure 2.10 Rat fatty acid binding protein 2IFB, a was found to have 92.5% homology to 14 KDa Selenium binding protein purified from rat liver using column chromatography and SDS-Gel techniques.([ref 3])































Explore SBP features and structural summary here [3].The domains of SBP are shown here [4] Notice how the domains are similar to the putative Isomerase domains of E.coli on Figure 2.11below.


1RI6 DOMAINS

full structure


Domain 1


Domain 2


Domain 3


2ECE DOMAINS


Domain 3


Domain 2


Domain 1


full structure








Figure 2.12Complex Of Bovine Odorant Binding Protein (Obp) With A Selenium Containing Odorant)"Image:Ligand of bovine.png" [[2]]


































Back to results Results 2ece

Back to main page Selenium binding protein