Structural analysis of 2qgn: Difference between revisions

From MDWiki
Jump to navigationJump to search
Line 77: Line 77:
A total of 527 hits were found from DALI search, nonetheless only the first 20 hits that may be of significance were shown on the figure. Based on the outcome of DALI and Profunc, PDB files of each structurally similar protein was obtained from PDB. These were each superimposed against 2qgn using the PyMOL software, to compare the structural similiarity. Results are as below :  
A total of 527 hits were found from DALI search, nonetheless only the first 20 hits that may be of significance were shown on the figure. Based on the outcome of DALI and Profunc, PDB files of each structurally similar protein was obtained from PDB. These were each superimposed against 2qgn using the PyMOL software, to compare the structural similiarity. Results are as below :  


[[Image:2qgn421.jpg|framed|left|'''Figure 7''' 3crq superimposed against 2qgn via PyMOL.]][[Image:2qgn2.png|framed|left|'''Figure 8''' 3crm superimposed against 2qgn via PyMOL.]][[Image:2qgn.png|framed|left|'''Figure 9''' 2ze7 superimposed against 2qgn via PyMOL.]][[Image:2qor.jpg|framed|left|'''Figure 10''' 2qor superimposed against 2qgn via PyMOL.]]<BR>
[[Image:2qgn421.jpg|framed|left|'''Figure 7''' 3crq superimposed against 2qgn via PyMOL.]][[Image:2qgn2.png|framed|left|'''Figure 8''' 3crm superimposed against 2qgn via PyMOL.]]<BR> <BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR>
 
[[Image:2qgn.png|framed|left|'''Figure 9''' 2ze7 superimposed against 2qgn via PyMOL.]][[Image:2qor.jpg|framed|left|'''Figure 10''' 2qor superimposed against 2qgn via PyMOL.]]<BR>
<BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR>
<BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR><BR>


As indicated by the figures above, each structures were structurally similar to 2qgn. This suggests that they could have functionally similar properties.
As indicated by the figures above, each structures were structurally similar to 2qgn. This suggests that they could have functionally similar properties.

Revision as of 06:01, 3 June 2008

General Properties of 2qgn

General information collected from PDB indicates that :

(a) 2qgn is a tRNA isopentenyl transferase isolated from Bacillus holodurans c-125, expressed in Escherichia Coli.

(b) Also known as tRNA delta(2)-isopentenylpyrophosphate transferase, belongs to the IPP transferase family

(c) Resolution of 2.4 angstroms

(d) Ligand chemical component identified as sulfate ion.

Protein Sequence in FASTA format

>gi|152149497|pdb|2QGN|A Chain A, Crystal Structure Of Trna Isopentenylpyrophosphate Transferase (Bh2366) From Bacillus Halodurans, Northeast Structural Genomics Consortium Target Bhr41. XKEKLVAIVGPTAVGKTKTSVXLAKRLNGEVISGDSXQVYRGXDIGTAKITAEEXDGVPHHLIDIKDPSE SFSVADFQDLATPLITEIHERGRLPFLVGGTGLYVNAVIHQFNLGDIRADEDYRHELEAFVNSYGVQALH DKLSKIDPKAAAAIHPNNYRRVIRALEIIKLTGKTVTEQARHEEETPSPYNLVXIGLTXERDVLYDRINR RVDQXVEEGLIDEAKKLYDRGIRDCQSVQAIGYKEXYDYLDGNVTLEEAIDTLKRNSRRYAKRQLTWFRN KANVTWFDXTDVDFDKKIXEIHNFIAGKLEEKSKLEHHHHHH

Structure of Protein

Figure 1
Structure of tRNA isopentenyl transferase 1 showing helix, sheet and loop. Image constructed from PyMOL.


Secondary Structure

Analysis of the secondary structure acquired from Protein Data Bank showed results as displayed below :

Secondary.jpg

Surface Properties

Figure 2
Surface property displayed by 2qgn. Red colour indicates negatively charged regions, while blue colour indicates positively charged regions.



Domains

2qgnA is composed of two main domains. CATH analysis of 2qgn resulted in the finding of two main domains composing 2qgnA.

Domain 1 ranges from residue 2-200 and residue 283-314. Domain 2 encompasses residues stretching from 201-282.

Figure 4
Two main domains exhibited by tRNA isopentenyl transferase(2qgnA). Blue regions denote first domain while Red regions underlies second domain.


Figure 5Ribbon structure of domain 2 signified by red regions in Figure 4.
Figure 6Structural representation of domain 1 denoted by blue regions in Figure 4.
























Ligand Binding Sites and Surface Clefts

Ligand.png
Surface cleft.png

Protein-ligand interaction

Hydrophillic binding sites

File:Hydrophillic.jpg

Bridged-H-bond binding sites

File:H-bond.jpg

Hydrophobic binding sites

File:Hydrophobic.jpg

Structural Alignment

Profunc

Related protein sequences

Profunc.jpg

Proteins with similar fold

Ssm.jpg

Dali Output

PDB entry code for 2qgn was loaded onto DALI server to search for structurally similar neighbours. Displayed below are the results from DALI search :-

Dali output.jpg

A total of 527 hits were found from DALI search, nonetheless only the first 20 hits that may be of significance were shown on the figure. Based on the outcome of DALI and Profunc, PDB files of each structurally similar protein was obtained from PDB. These were each superimposed against 2qgn using the PyMOL software, to compare the structural similiarity. Results are as below :

Figure 7 3crq superimposed against 2qgn via PyMOL.
Figure 8 3crm superimposed against 2qgn via PyMOL.
























Figure 9 2ze7 superimposed against 2qgn via PyMOL.
Figure 10 2qor superimposed against 2qgn via PyMOL.
























As indicated by the figures above, each structures were structurally similar to 2qgn. This suggests that they could have functionally similar properties.