Structure of 1zkd: Difference between revisions

From MDWiki
Jump to navigationJump to search
No edit summary
No edit summary
Line 18: Line 18:


Most probably a transferase as most of the matches from DALI are transferase
Most probably a transferase as most of the matches from DALI are transferase
## SUMMARY: PDB/chain identifiers and structural alignment statistics
NR. STRID1 STRID2  Z  RMSD LALI LSEQ2 %IDE REVERS PERMUT NFRAG TOPO PROTEIN
  1: 3027-A 1zkd-A 56.8  0.0  349  349  100      0      0    1 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    duf185  (rhodops
  2: 3027-A 2ex4-A 11.7  3.0  185  221  12      0      0    22 S    TRANSFERASE      adrenal gland protein ad-003    (homo sapien
  3: 3027-A 1im8-A 11.6  3.2  178  225  10      0      0    18 S    TRANSFERASE    yeco (methyltransferase, hypothetical pro
  4: 3027-A 2gb4-A 10.8  3.3  184  231  13      0      0    19 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
  5: 3027-A 2fk7-A 10.7  3.8  186  277  14      0      0    19 S    TRANSFERASE      methoxy mycolic acid synthase 4        (mycobact
  6: 3027-A 2ob1-A 10.2  3.9  196  319    9      0      0    23 S    TRANSFERASE      leucine carboxyl methyltransferase 1 (prot
  7: 3027-A 2f8l-A 10.0  3.7  182  318    8      0      0    22 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    hypothetical pro
  8: 3027-A 2avn-A 10.0  3.7  183  242  11      0      0    20 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    ubiquinoneMENAQU
  9: 3027-A 2bzg-A  9.9  3.4  182  226  13      0      0    20 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
10: 3027-A 2aot-A  9.8  4.3  182  285  13      0      0    23 S    TRANSFERASE      histamine n-methyltransferase (hmt)    (homo
11: 3027-A 2p8j-A  9.7  3.4  168  203  10      0      0    16 S    TRANSFERASE      s-adenosylmethionine-dependent methyltrans
12: 3027-A 1vl5-A  9.7  3.3  167  225    9      0      0    18 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    unknown conserve
13: 3027-A 1hnn-A  9.7  3.4  183  261  13      0      0    18 S    TRANSFERASE    phenylethanolamine n-methyltransferase (p
14: 3027-A 1m6e-X  9.6  3.6  206  359    9      0      0    27 S    TRANSFERASE      s-adenosyl-l-methionnine:salicylic acid ca
15: 3027-A 2fay-A  9.5  3.9  178  274  14      0      0    21 S
16: 3027-A 2h00-A  9.2  2.9  158  225    9      0      0    18 S    TRANSFERASE      methyltransferase 10 domain containing pro
17: 3027-A 1wy7-A  9.2  3.1  155  195  13      0      0    15 S    TRANSFERASE      hypothetical protein ph1948    (pyrococcus h
18: 3027-A 1m6y-A  8.8  4.3  156  289  10      0      0    19 S    TRANSFERASE      s-adenosyl-methyltransferase mraw      (thermo
19: 3027-A 1i9g-A  8.7  3.0  149  264    9      0      0    15 S    TRANSFERASE    hypothetical protein rv2118c    (mycobacter
20: 3027-A 1zq9-A  8.6  3.2  144  278  16      0      0    19 S    TRANSFERASE      probable dimethyladenosine transferase (s-

Revision as of 05:49, 8 May 2007

MIDQTALATEIKRLIKAAGPMPVWRYMELCLGHPEHGYYVTRDPLGREGDFTTSPEISQMFGELLGLWSASVWKAADEPQ TLRLIEIGPGRGTMMADALRALRVLPILYQSLSVHLVEINPVLRQKQQTLLAGIRNIHWHDSFEDVPEGPAVILANEYFD VLPIHQAIKRETGWHERVIEIGASGELVFGVAADPIPGFEALLPPLARLSPPGAVFEWRPDTEILKIASRVRDQGGAALI IDYGHLRSDVGDTFQAIASHSYADPLQHPGRADLTAHVDFDALGRAAESIGARAHGPVTQGAFLKRLGIETRALSLMAKA TPQVSEDIAGALQRLTGEGRGAMGSMFKVIGVSDPKIETLVALSDDTDREAERRQGTHGLEHHHHHH

1zkd

http://www.rcsb.org/pdb/explore/explore.do?structureId=1ZKD

Located on 2p22.2 on human chromosome with 441 aa

Located on 17E3 on mouse chromosome with 436 aa

DUF185 domain identified by Pfam

Nearest match using Dali 2ex4 - http://www.rcsb.org/pdb/explore/explore.do?structureId=2EX4

Most probably a transferase as most of the matches from DALI are transferase

    1. SUMMARY: PDB/chain identifiers and structural alignment statistics
NR. STRID1 STRID2  Z   RMSD LALI LSEQ2 %IDE REVERS PERMUT NFRAG TOPO PROTEIN
 1: 3027-A 1zkd-A 56.8  0.0  349   349  100      0      0     1 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    duf185  (rhodops
 2: 3027-A 2ex4-A 11.7  3.0  185   221   12      0      0    22 S    TRANSFERASE      adrenal gland protein ad-003    (homo sapien
 3: 3027-A 1im8-A 11.6  3.2  178   225   10      0      0    18 S     TRANSFERASE     yeco (methyltransferase, hypothetical pro
 4: 3027-A 2gb4-A 10.8  3.3  184   231   13      0      0    19 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
 5: 3027-A 2fk7-A 10.7  3.8  186   277   14      0      0    19 S    TRANSFERASE      methoxy mycolic acid synthase 4         (mycobact
 6: 3027-A 2ob1-A 10.2  3.9  196   319    9      0      0    23 S    TRANSFERASE      leucine carboxyl methyltransferase 1 (prot
 7: 3027-A 2f8l-A 10.0  3.7  182   318    8      0      0    22 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    hypothetical pro
 8: 3027-A 2avn-A 10.0  3.7  183   242   11      0      0    20 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    ubiquinoneMENAQU
 9: 3027-A 2bzg-A  9.9  3.4  182   226   13      0      0    20 S    TRANSFERASE      thiopurine s-methyltransferase (thiopurine
10: 3027-A 2aot-A  9.8  4.3  182   285   13      0      0    23 S    TRANSFERASE      histamine n-methyltransferase (hmt)     (homo
11: 3027-A 2p8j-A  9.7  3.4  168   203   10      0      0    16 S    TRANSFERASE      s-adenosylmethionine-dependent methyltrans
12: 3027-A 1vl5-A  9.7  3.3  167   225    9      0      0    18 S    STRUCTURAL GENOMICS, UNKNOWN FUNCTION    unknown conserve
13: 3027-A 1hnn-A  9.7  3.4  183   261   13      0      0    18 S     TRANSFERASE     phenylethanolamine n-methyltransferase (p
14: 3027-A 1m6e-X  9.6  3.6  206   359    9      0      0    27 S    TRANSFERASE      s-adenosyl-l-methionnine:salicylic acid ca
15: 3027-A 2fay-A  9.5  3.9  178   274   14      0      0    21 S
16: 3027-A 2h00-A  9.2  2.9  158   225    9      0      0    18 S    TRANSFERASE      methyltransferase 10 domain containing pro
17: 3027-A 1wy7-A  9.2  3.1  155   195   13      0      0    15 S    TRANSFERASE      hypothetical protein ph1948     (pyrococcus h
18: 3027-A 1m6y-A  8.8  4.3  156   289   10      0      0    19 S    TRANSFERASE      s-adenosyl-methyltransferase mraw       (thermo
19: 3027-A 1i9g-A  8.7  3.0  149   264    9      0      0    15 S     TRANSFERASE     hypothetical protein rv2118c    (mycobacter
20: 3027-A 1zq9-A  8.6  3.2  144   278   16      0      0    19 S    TRANSFERASE      probable dimethyladenosine transferase (s-