COASY results

Structure of Coenzyme A Synthase

Conezyme A Synthase is structurally composed of seven strands, eleven helices and thirteen beta turns (EMBL EBI, 2005) (see Figure 1). Analysis of structurally related proteins (Holm & Sander, 1993) showed a trend for transferase (RCSB, 2007) class proteins with Rossmann class folds (Rossmann, 1973). The Rossmann topologies of fold’s are an alpha-beta class fold that forms a three or more layer beta strand sandwich alternating with alpha helices (beta-alpha-beta-alpha-beta). PFAM classification placed these into either the Cytidylyltransferase or Dephospho-CoA kinase familes, matching the two domains of Coenzyme A Synthase. Those classified under the Dephospho-CoA kinase type were commonly of the P-loop containing nucleotide triphosphate hydrolases (Sanger Institute, 2005) homology whilst those classified as Cytidylyltransferase were of the Tyrosol-Transfer RNA Synthetase (Sanger Institute, 2005). As the majority of the structurally related proteins identified contained the DPCK domain solely, and the motif for a P-loop (Table 1) was identified in the Conzyme A Synthase sequence (Bairoch, Bucher, & Hofmann, 1997) it is suggested that Coenzyme A Synthase is also of the P-loop containing nucleotide triphosphate hydrolases homology of folds.

Table 1

PROSITE Motif search (Bairoch, Bucher, & Hofmann, 1997) results on Coenzyme A Synthase: Mus. musculus.

Cell 1

Cell 2

Cell 3

Pattern-ID: GLYCOSAMINOGLYCAN PS00002 PDOC00002

Pattern-DE: Glycosaminoglycan attachment site

Pattern: SG.G

Position: 84 SGSG

Pattern-ID: PKC_PHOSPHO_SITE PS00005 PDOC00005

Pattern-DE: Protein kinase C phosphorylation site

Pattern: Pattern: [ST].[RK]

Position: 3 SDK

Position: 52 SFR

Position: 86 SGK

Pattern-ID: CK2_PHOSPHO_SITE PS00006 PDOC00006

Pattern-DE: Casein kinase II phosphorylation site

Pattern: [ST].{2}[DE]

Position: 39 SHNE

Position: 251 TLWE

Position: 260 SQVE

Pattern-ID: MYRISTYL PS00008 PDOC00008

Pattern-DE: N-myristoylation site

Pattern: G[^EDRKHPFYW].{2}[STAGCN][^P]

Position: 82 GISGSG

Position: 222 GLSEAA

Pattern-ID: ATP_GTP_A PS00017 PDOC00017

Pattern-DE: ATP/GTP-binding site motif A (P-loop)

Pattern: [AG].{4}GK[ST]

Position: 82 GISGSGKS

Pattern-ID: UPF0038 PS01294 PDOC00996

Pattern-DE: Uncharacterized protein family UPF0038 signature

Pattern: G.[LI].R.{2}L.{4}F.{8}[LIV].{5}P.[LIV]

Position: 136 GTINRKVLGSRVFGNKKQMKILTDIVWPVI

Figure 1

The secondary structure of Mus musculus with indicated ligand interaction sites (EMBL EBI, 2005).

Figure 2

Structural alignment of structurally related proteins to Mus. musculus Coenzyme A Synthase

Structural Elements and Functional Binding Sites of Coenzyme A Synthase

---

Abstract | Introduction | Results | Discussion | Conclusion | Method | References

Back To Main CoA Synthase Page