COASY results: Difference between revisions

From MDWiki
Jump to navigationJump to search
Line 20: Line 20:
|'''Position:'''
|'''Position:'''
|84 SGSG
|84 SGSG
|-
| ---
| ---
|-
|-
|'''Pattern-ID:'''
|'''Pattern-ID:'''

Revision as of 13:40, 9 June 2007

Structure of Coenzyme A Synthase

Conezyme A Synthase is structurally composed of seven strands, eleven helices and thirteen beta turns (EMBL EBI, 2005) (see Figure 1). Analysis of structurally related proteins (Holm & Sander, 1993) showed a trend for transferase (RCSB, 2007) class proteins with Rossmann class folds (Rossmann, 1973). The Rossmann topologies of fold’s are an alpha-beta class fold that forms a three or more layer beta strand sandwich alternating with alpha helices (beta-alpha-beta-alpha-beta). PFAM classification placed these into either the Cytidylyltransferase or Dephospho-CoA kinase familes, matching the two domains of Coenzyme A Synthase. Those classified under the Dephospho-CoA kinase type were commonly of the P-loop containing nucleotide triphosphate hydrolases (Sanger Institute, 2005) homology whilst those classified as Cytidylyltransferase were of the Tyrosol-Transfer RNA Synthetase (Sanger Institute, 2005). As the majority of the structurally related proteins identified contained the DPCK domain solely, and the motif for a P-loop (Table 1) was identified in the Conzyme A Synthase sequence (Bairoch, Bucher, & Hofmann, 1997) it is suggested that Coenzyme A Synthase is also of the P-loop containing nucleotide triphosphate hydrolases homology of folds.


Table 1

PROSITE Motif search (Bairoch, Bucher, & Hofmann, 1997) results on Coenzyme A Synthase: Mus. musculus.
Pattern-ID: GLYCOSAMINOGLYCAN PS00002 PDOC00002
Pattern-DE: Glycosaminoglycan attachment site
Pattern: SG.G
Position: 84 SGSG
Pattern-ID: PKC_PHOSPHO_SITE PS00005 PDOC00005
Pattern-DE: Protein kinase C phosphorylation site
Pattern: [ST].[RK]
Position: 3 SDK
Position: 52 SFR
Position: 86 SGK
Pattern-ID: CK2_PHOSPHO_SITE PS00006 PDOC00006
Pattern-DE: Casein kinase II phosphorylation site
Pattern: [ST].{2}[DE]
Position: 39 SHNE
Position: 251 TLWE
Position: 260 SQVE
Pattern-ID: MYRISTYL PS00008 PDOC00008
Pattern-DE: N-myristoylation site
Pattern: G[^EDRKHPFYW].{2}[STAGCN][^P]
Position: 82 GISGSG
Position: 222 GLSEAA
Pattern-ID: ATP_GTP_A PS00017 PDOC00017
Pattern-DE: ATP/GTP-binding site motif A (P-loop)
Pattern: [AG].{4}GK[ST]
Position: 82 GISGSGKS
Pattern-ID: UPF0038 PS01294 PDOC00996
Pattern-DE: Uncharacterized protein family UPF0038 signature
Pattern: G.[LI].R.{2}L.{4}F.{8}[LIV].{5}P.[LIV]
Position: 136 GTINRKVLGSRVFGNKKQMKILTDIVWPVI

Figure 1

The secondary structure of Mus musculus with indicated ligand interaction sites (EMBL EBI, 2005).
COASYSecondary structure with bind sites.gif


Figure 2

Structural alignment of structurally related proteins to Mus. musculus Coenzyme A Synthase
COASYStructureconservationstructurealignment.JPG


Localisation Expression of Coenzyme A Synthase

Sequence Conservation of Coenzyme A Synthase

Structural Elements and Functional Binding Sites of Coenzyme A Synthase


Abstract | Introduction | Results | Discussion | Conclusion | Method | References

Back To Main CoA Synthase Page