Phytanoyl-CoA intro: Difference between revisions

From MDWiki
Jump to navigationJump to search
No edit summary
No edit summary
Line 11: Line 11:
using this our aim has been to elucidate as much information about the potential protein as possible. We will be aiming to cover three main areas - Structure (Daniel), Sequence and Evolution (Eleanor) and Function (Liam). By covering all three of these areas we expect to gain oversight, hopefully, allowing us to deduce some of the properties of the protein, for example -
using this our aim has been to elucidate as much information about the potential protein as possible. We will be aiming to cover three main areas - Structure (Daniel), Sequence and Evolution (Eleanor) and Function (Liam). By covering all three of these areas we expect to gain oversight, hopefully, allowing us to deduce some of the properties of the protein, for example -


binding sites
binding sites <br>
phloygeny trees
phloygeny trees <br>
structural similarities
structural similarities <br>
conservation of domains
conservation of domains <br>

Revision as of 06:16, 8 June 2008

Abstract | Introduction | Results | Discussion | Conclusion | Method | References

Biochemistry, genetics and bioinformatics are three of the quickest growing fields in modern research. They have quickly established themselves over the last decade as better computer techniques have been made available. This increase in the quality of instrumentation has lead to an explosion of new genomic data to analyse, the majority of which is available online for public access.

Our aim in this project is as follows;

we were given a target sequence -

>gi|134105315|pdb|2OPW|A Chain A, Crystal Structure Of Human Phytanoyl-Coa Dioxygenase Phyhd1 (Apo) MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYF LSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQS MYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSA PGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQP TAELPFPQLYT

using this our aim has been to elucidate as much information about the potential protein as possible. We will be aiming to cover three main areas - Structure (Daniel), Sequence and Evolution (Eleanor) and Function (Liam). By covering all three of these areas we expect to gain oversight, hopefully, allowing us to deduce some of the properties of the protein, for example -

binding sites
phloygeny trees
structural similarities
conservation of domains